PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G22680.1
Common NameAtMYB85, MYB85
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 266aa    MW: 30408.9 Da    PI: 5.0698
Description myb domain protein 85
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G22680.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
      AT4G22680.1 14 KGPWTVEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
      AT4G22680.1  71 SHDEEQLVIDLHANLGNK-WSKIASRLP-GRTDNEIKNHWNTH 111
                      789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.787961IPR017930Myb domain
SuperFamilySSF466891.8E-2611108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002491.6E-131461IPR001005SANT/Myb domain
CDDcd001671.73E-81661No hitNo description
PROSITE profilePS5129426.73362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2463116IPR009057Homeodomain-like
SMARTSM007179.6E-1466114IPR001005SANT/Myb domain
CDDcd001672.76E-1071112No hitNo description
PfamPF002491.5E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0005352anatomyxylem
PO:0005848anatomysecondary xylem
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTVE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVID LHANLGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPMTHQPLN QEPSNIDNSK TIPSNPDDVS VEPKTTNTKY VEISVTTTEE ESSSTVTDQN  180
SSMDNENHLI DNIYDDDELF SYLWSDETTK DEASWSDSNF GVGGTLYDHN ISGADADFPI  240
WSPERINDEK MFLDYCQDFG VHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306858890.0
Genevisible254277_at0.0
Expression AtlasAT4G22680-
AtGenExpressAT4G22680-
ATTED-IIAT4G22680-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB85).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G22680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A), AT5G12870 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G22680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759930.0AF175993.2 Arabidopsis thaliana putative transcription factor (MYB85) mRNA, complete cds.
GenBankAK1757180.0AK175718.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-25-P15.
GenBankAK1757770.0AK175777.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-35-I17.
GenBankAY5196080.0AY519608.1 Arabidopsis thaliana MYB transcription factor (At4g22680) mRNA, complete cds.
GenBankDQ4468630.0DQ446863.1 Arabidopsis thaliana clone pENTR221-At4g22680 myb family transcription factor (At4g22680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567664.10.0myb domain protein 85
SwissprotQ50EX64e-92ODO1_PETHY; Protein ODORANT1
TrEMBLQ94GA60.0Q94GA6_ARATH; MYB transcription factor
STRINGAT4G22680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  6. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  7. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  8. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]